PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G184500.1
Common NamePHAVU_002G184500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family BBR-BPC
Protein Properties Length: 343aa    MW: 38845.7 Da    PI: 9.7305
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G184500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind3145e-96643421301
           GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssiaerdaki....rernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllv 87 
                         mddd  +  n+gyyep      +lglqlm  +++rd+k+    r+  l l++ ++++++rd    +  + l+   ++ + ++++++++++ 
  Phvul.002G184500.1  64 MDDDVLNMPNWGYYEPF--RGGHLGLQLMPGMTDRDTKPylpaRDPAL-LMGANGTFHPRDCVVSEAPMQLNYVRDNWTSQRDRYFNMQQP 151
                         899988779******98..4579****************9*9888888.99**********555555555555444444447788888885 PP

           GAGA_bind  88 enslasalpvgvqvlsgtksidslqqlsepqledsave.lreeeklealpieeaaeeakekkkkkkrqr...akkpkekkakkkkkkseks 174
                         +n       +++ vl++t+ +  lq      ++++ +   ++ + +e+l ++      ke  ++kkrq+    ++p++kk +k+k+     
  Phvul.002G184500.1 152 TN-------PNYAVLPETSVAPYLQI-----IQPPDTSrDEKVDRIEELVVK------KEGGQSKKRQTkgaLTTPQAKKPRKPKD----- 219
                         55.......57899********9999.....333333312233333333333......3334444344400044444444445444..... PP

           GAGA_bind 175 kkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgaf 265
                           +++ +   +r+k +kk+++lv+ng+++D+s+lP+PvCsCtG+++qCY+WG+GGWqSaCCtt++S+yPLP+s krrgaRiagrKmSqgaf
  Phvul.002G184500.1 220 --NSNVPV--QRVKPPKKTMELVINGIDMDISGLPIPVCSCTGSPQQCYRWGCGGWQSACCTTNVSIYPLPMSMKRRGARIAGRKMSQGAF 306
                         ..555666..689****************************************************************************** PP

           GAGA_bind 266 kklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                         kk+LekLaaeGy+++np+DLk+hWA+HGtnkfvtir
  Phvul.002G184500.1 307 KKVLEKLAAEGYNFANPIDLKTHWARHGTNKFVTIR 342
                         ***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012263.3E-15664342IPR010409GAGA-binding transcriptional activator
PfamPF062177.1E-10564342IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MEIYKWPTNM LKEVDRGIRP NINEWYDTIL DSTRWILAND FCLSHLSLSG RANPKDRLHP  60
PIVMDDDVLN MPNWGYYEPF RGGHLGLQLM PGMTDRDTKP YLPARDPALL MGANGTFHPR  120
DCVVSEAPMQ LNYVRDNWTS QRDRYFNMQQ PTNPNYAVLP ETSVAPYLQI IQPPDTSRDE  180
KVDRIEELVV KKEGGQSKKR QTKGALTTPQ AKKPRKPKDN SNVPVQRVKP PKKTMELVIN  240
GIDMDISGLP IPVCSCTGSP QQCYRWGCGG WQSACCTTNV SIYPLPMSMK RRGARIAGRK  300
MSQGAFKKVL EKLAAEGYNF ANPIDLKTHW ARHGTNKFVT IR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007158817.10.0hypothetical protein PHAVU_002G184500g
SwissprotQ9LDE21e-105BPC2_ARATH; Protein BASIC PENTACYSTEINE2
TrEMBLV7CPG30.0V7CPG3_PHAVU; Uncharacterized protein
STRINGGLYMA08G09780.20.0(Glycine max)
STRINGGLYMA05G26790.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23703283
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.31e-106basic pentacysteine 2